PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A11G0981
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 293aa    MW: 33510.2 Da    PI: 6.2655
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A11G0981genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding591e-182370148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd  l+  v+ +G g+W+++ar  g++Rt+k+c++rw++y+
      Gh_A11G0981 23 KGPWTEEEDSMLKAHVNIHGEGRWNAVARLSGLRRTGKSCRLRWLNYM 70
                     79********************************************97 PP

2Myb_DNA-binding50.35.6e-1676119146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ + eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
      Gh_A11G0981  76 RGNISLEEQLLILELHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 119
                      78899*****************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-221673IPR009057Homeodomain-like
PROSITE profilePS5129424.951874IPR017930Myb domain
SuperFamilySSF466891.65E-3020117IPR009057Homeodomain-like
SMARTSM007172.9E-162272IPR001005SANT/Myb domain
PfamPF002494.4E-162369IPR001005SANT/Myb domain
CDDcd001672.16E-112570No hitNo description
Gene3DG3DSA:1.10.10.604.5E-2274124IPR009057Homeodomain-like
PROSITE profilePS5129419.47975125IPR017930Myb domain
SMARTSM007171.2E-1475123IPR001005SANT/Myb domain
PfamPF002499.5E-1576119IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MDVYKRGFIS ETSRNEEEME LRKGPWTEEE DSMLKAHVNI HGEGRWNAVA RLSGLRRTGK  60
SCRLRWLNYM RPEIKRGNIS LEEQLLILEL HSRWGNRWSK IAQHLPGRTD NEIKNYWRTR  120
VQKQAKQLNC DVNSKQFKDA MRYVWIPRLV ERIRASSESP SSQPSTTTKT TYNDCISNIS  180
SSQMSYANAS GSVQVDPSLL PELSGTSSDS LDTQVSSVSD LTDCYNPQSL SNYLHKGLGL  240
EKEGAATWGR DEEFQATEEH SNGWLVGGGE SSMDTVWNEE NVWFLQQQLR DGI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-262012524128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO29213370.0
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT2819170.0KT281917.1 Gossypium hirsutum MYB protein 108 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012490294.10.0PREDICTED: transcription factor MYB108-like
SwissprotQ9LDE13e-74MY108_ARATH; Transcription factor MYB108
TrEMBLQ94JN40.0Q94JN4_G
STRINGPOPTR_0002s19250.11e-103(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49620.12e-76myb domain protein 78